Lineage for d1h0da1 (1h0d A:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2741155Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (28 PDB entries)
  8. 2741163Domain d1h0da1: 1h0d A:1-106 [83425]
    Other proteins in same PDB: d1h0da2, d1h0db1, d1h0db2, d1h0dc_
    part of anti-angiogenin FAB; conflict: annotated in PDB as human
    complexed with gol, so4

Details for d1h0da1

PDB Entry: 1h0d (more details), 2 Å

PDB Description: crystal structure of human angiogenin in complex with fab fragment of its monoclonal antibody mab 26-2f
PDB Compounds: (A:) antibody fab fragment, light chain

SCOPe Domain Sequences for d1h0da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h0da1 b.1.1.1 (A:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
divltqspaslavslgqratiscrasesvdnygisfmswfqqkpgqppklliyaasnqgs
gvparfsgsgsgtdfslnihpmeeddtamyfcqqskevpltfgagtklelk

SCOPe Domain Coordinates for d1h0da1:

Click to download the PDB-style file with coordinates for d1h0da1.
(The format of our PDB-style files is described here.)

Timeline for d1h0da1: