Lineage for d1h0ba_ (1h0b A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 555833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 556586Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 556587Protein Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain [49991] (7 species)
  7. 556602Species Rhodothermus marinus [TaxId:29549] [89275] (1 PDB entry)
  8. 556603Domain d1h0ba_: 1h0b A: [83422]

Details for d1h0ba_

PDB Entry: 1h0b (more details), 1.8 Å

PDB Description: endoglucanase cel12a from rhodothermus marinus

SCOP Domain Sequences for d1h0ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h0ba_ b.29.1.11 (A:) Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain {Rhodothermus marinus}
tvelcgrwdardvaggryrvinnvwgaetaqcievgletgnftitradhdngnnvaaypa
iyfgchwgactsnsglprrvqelsdvrtswtltpittgrwnaaydiwfspvtnsgngysg
gaelmiwlnwnggvmpggsrvatvelagatwevwyadwdwnyiayrrttpttsvseldlk
afiddavargyirpewylhavetgfelweggaglrsadfsvtvqkla

SCOP Domain Coordinates for d1h0ba_:

Click to download the PDB-style file with coordinates for d1h0ba_.
(The format of our PDB-style files is described here.)

Timeline for d1h0ba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1h0bb_