Lineage for d1h0ba_ (1h0b A:)
- Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) 
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins) 
Protein Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain [49991] (6 species) 
Species Rhodothermus marinus [TaxId:29549] [89275] (1 PDB entry) 
Domain d1h0ba_: 1h0b A: [83422]
Details for d1h0ba_
PDB Entry: 1h0b (more details), 1.8 Å
PDB Description: endoglucanase cel12a from rhodothermus marinus
SCOP Domain Sequences for d1h0ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h0ba_ b.29.1.11 (A:) Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain {Rhodothermus marinus}
tvelcgrwdardvaggryrvinnvwgaetaqcievgletgnftitradhdngnnvaaypa
iyfgchwgactsnsglprrvqelsdvrtswtltpittgrwnaaydiwfspvtnsgngysg
gaelmiwlnwnggvmpggsrvatvelagatwevwyadwdwnyiayrrttpttsvseldlk
afiddavargyirpewylhavetgfelweggaglrsadfsvtvqkla
SCOP Domain Coordinates for d1h0ba_:
Click to download the PDB-style file with coordinates for d1h0ba_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h0ba_:
- d1h0ba_ is new in SCOP 1.65
- d1h0ba_ appears in SCOP 1.67
- d1h0ba_ appears in the current release, SCOPe 2.08
View in 3D
