SCOP 1.73: Domain d1h03p1: 1h03 P:5-66

Lineage for d1h03p1 (1h03 P:5-66)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (13 proteins)
   Pfam PF00084

6. Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [90173] (15 PDB entries)

8. Domain d1h03p1: 1h03 P:5-66 [83411]

Details for d1h03p1

PDB Entry: 1h03, 1.7 Å

PDB Description: human cd55 domains 3 & 4

PDB Compounds: (P:) complement decay-accelerating factor

SCOP Domain Sequences for d1h03p1:

Sequence; same for both SEQRES and ATOM records:

>d1h03p1 g.18.1.1 (P:5-66) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}
kscpnpgeirngqidvpggilfgatisfscntgyklfgstssfclisgssvqwsdplpec
re

Timeline for d1h03p1:

• d1h03p1 first appeared in SCOP 1.65
  
• d1h03p1 appears in SCOP 1.71
  
• d1h03p1 appears in SCOP 1.75
  
• d1h03p1 appears in the current release, SCOPe 2.08