Lineage for d1gxie_ (1gxi E:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 461193Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 461565Superfamily b.34.4: Electron transport accessory proteins [50090] (4 families) (S)
  5. 461571Family b.34.4.2: Photosystem I accessory protein E (PsaE) [50094] (1 protein)
  6. 461572Protein Photosystem I accessory protein E (PsaE) [50095] (4 species)
  7. 461579Species Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId:1148] [89302] (1 PDB entry)
  8. 461580Domain d1gxie_: 1gxi E: [83373]

Details for d1gxie_

PDB Entry: 1gxi (more details)

PDB Description: psae subunit of the photosystem i of the cyanobacterium synechocystis sp. pcc 6803

SCOP Domain Sequences for d1gxie_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gxie_ b.34.4.2 (E:) Photosystem I accessory protein E (PsaE) {Cyanobacterium (Synechocystis sp.), pcc 6803}
alnrgdkvrikrtesywygdvgtvasveksgilypvivrfdrvnyngfsgsasgvntnnf
aenelelvqaaak

SCOP Domain Coordinates for d1gxie_:

Click to download the PDB-style file with coordinates for d1gxie_.
(The format of our PDB-style files is described here.)

Timeline for d1gxie_: