![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) ![]() |
![]() | Family b.34.4.2: Photosystem I accessory protein E (PsaE) [50094] (2 proteins) automatically mapped to Pfam PF02427 |
![]() | Protein Photosystem I accessory protein E (PsaE) [50095] (5 species) |
![]() | Species Synechocystis sp. PCC 6803 [TaxId:1148] [89302] (2 PDB entries) |
![]() | Domain d1gxie_: 1gxi E: [83373] |
PDB Entry: 1gxi (more details)
SCOPe Domain Sequences for d1gxie_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gxie_ b.34.4.2 (E:) Photosystem I accessory protein E (PsaE) {Synechocystis sp. PCC 6803 [TaxId: 1148]} alnrgdkvrikrtesywygdvgtvasveksgilypvivrfdrvnyngfsgsasgvntnnf aenelelvqaaak
Timeline for d1gxie_: