Lineage for d1gv5a_ (1gv5 A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 277521Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 277522Superfamily a.4.1: Homeodomain-like [46689] (11 families) (S)
    consists only of helices
  5. 277664Family a.4.1.3: Myb [46739] (4 proteins)
  6. 277669Protein c-Myb, DNA-binding domain [46740] (1 species)
    duplication
  7. 277670Species Mouse (Mus musculus) [TaxId:10090] [46742] (16 PDB entries)
  8. 277672Domain d1gv5a_: 1gv5 A: [83337]
    repeat 2
    complexed with na

Details for d1gv5a_

PDB Entry: 1gv5 (more details), 1.58 Å

PDB Description: crystal structure of c-myb r2

SCOP Domain Sequences for d1gv5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gv5a_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus)}
likgpwtkeedqrviklvqkygpkrwsviakhlkgrigkqcrerwhnhlnpe

SCOP Domain Coordinates for d1gv5a_:

Click to download the PDB-style file with coordinates for d1gv5a_.
(The format of our PDB-style files is described here.)

Timeline for d1gv5a_: