Lineage for d1gv2a1 (1gv2 A:89-143)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1477566Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1477818Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)
  6. 1477826Protein c-Myb, DNA-binding domain [46740] (1 species)
    duplication
  7. 1477827Species Mouse (Mus musculus) [TaxId:10090] [46742] (16 PDB entries)
  8. 1477831Domain d1gv2a1: 1gv2 A:89-143 [83335]
    repeats 2 & 3
    complexed with na

Details for d1gv2a1

PDB Entry: 1gv2 (more details), 1.68 Å

PDB Description: crystal structure of c-myb r2r3
PDB Compounds: (A:) Myb proto-oncogene protein

SCOPe Domain Sequences for d1gv2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gv2a1 a.4.1.3 (A:89-143) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]}
elikgpwtkeedqrviklvqkygpkrwsviakhlkgrigkqcrerwhnhlnpevk

SCOPe Domain Coordinates for d1gv2a1:

Click to download the PDB-style file with coordinates for d1gv2a1.
(The format of our PDB-style files is described here.)

Timeline for d1gv2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gv2a2