| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.5: MurCD N-terminal domain [51983] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group |
Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) ![]() |
| Family c.5.1.1: MurCD N-terminal domain [51985] (2 proteins) |
| Protein UDP-N-acetylmuramate-alanine ligase MurC [82315] (2 species) |
| Species Haemophilus influenzae [TaxId:727] [89549] (4 PDB entries) |
| Domain d1gqyb1: 1gqy B:6-106 [83308] Other proteins in same PDB: d1gqya2, d1gqya3, d1gqyb2, d1gqyb3 complexed with acp, mg |
PDB Entry: 1gqy (more details), 1.8 Å
SCOPe Domain Sequences for d1gqyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gqyb1 c.5.1.1 (B:6-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]}
eeirkiipemrrvqqihfigiggagmsgiaeillnegyqisgsdiadgvvtqrlaqagak
iyighaeehiegasvvvvssaikddnpelvtskqkripviq
Timeline for d1gqyb1: