Lineage for d1gqqb1 (1gqq B:19-106)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2458695Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group
  4. 2458696Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) (S)
  5. 2458697Family c.5.1.1: MurCD N-terminal domain [51985] (2 proteins)
  6. 2458698Protein UDP-N-acetylmuramate-alanine ligase MurC [82315] (2 species)
  7. 2458699Species Haemophilus influenzae [TaxId:727] [89549] (4 PDB entries)
  8. 2458707Domain d1gqqb1: 1gqq B:19-106 [83302]
    Other proteins in same PDB: d1gqqa2, d1gqqa3, d1gqqb2, d1gqqb3

Details for d1gqqb1

PDB Entry: 1gqq (more details), 3.1 Å

PDB Description: murc - crystal structure of the apo-enzyme from haemophilus influenzae
PDB Compounds: (B:) udp-n-acetylmuramate-l-alanine ligase

SCOPe Domain Sequences for d1gqqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gqqb1 c.5.1.1 (B:19-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]}
qqihfigiggagmsgiaeillnegyqisgsdiadgvvtqrlaqagakiyighaeehiega
svvvvssaikddnpelvtskqkripviq

SCOPe Domain Coordinates for d1gqqb1:

Click to download the PDB-style file with coordinates for d1gqqb1.
(The format of our PDB-style files is described here.)

Timeline for d1gqqb1: