Lineage for d1gqqa3 (1gqq A:107-321)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 492652Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 492775Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (2 families) (S)
    has extra strand located between strands 1 and 2
  5. 492776Family c.72.2.1: MurCDEF [53624] (4 proteins)
  6. 492781Protein UDP-N-acetylmuramate-alanine ligase MurC [82520] (2 species)
  7. 492782Species Haemophilus influenzae [TaxId:727] [89776] (4 PDB entries)
  8. 492789Domain d1gqqa3: 1gqq A:107-321 [83301]
    Other proteins in same PDB: d1gqqa1, d1gqqa2, d1gqqb1, d1gqqb2

Details for d1gqqa3

PDB Entry: 1gqq (more details), 3.1 Å

PDB Description: murc - crystal structure of the apo-enzyme from haemophilus influenzae

SCOP Domain Sequences for d1gqqa3:

Sequence, based on SEQRES records: (download)

>d1gqqa3 c.72.2.1 (A:107-321) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae}
raqmlaeimrfrhgiavagthgkttttamismiytqakldptfvngglvksagknahlga
sryliaeadesdasflhlqpmvsvvtnmepdhmdtyegdfekmkatyvkflhnlpfygla
vmcaddpvlmelvpkvgrqvitygfseqadyriedyeqtgfqghytvicpnnerinvlln
vpgkhnalnataalavakeegianeailealadfq

Sequence, based on observed residues (ATOM records): (download)

>d1gqqa3 c.72.2.1 (A:107-321) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae}
raqmlaeimrfrhgiavagthgkttttamismiytqakldptfvsryliaeadeflhlqp
mvsvvtnmefekmkatyvkflhnlpfyglavmcaddpvlmelvpkvgrqvitygfseqad
yriedyeqtgfqghytvicpnnerinvllnvpgkhnalnataalavakeegianeailea
ladfq

SCOP Domain Coordinates for d1gqqa3:

Click to download the PDB-style file with coordinates for d1gqqa3.
(The format of our PDB-style files is described here.)

Timeline for d1gqqa3: