Lineage for d1gjja2 (1gjj A:111-153)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016973Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 2016974Superfamily a.140.1: LEM domain [63451] (1 family) (S)
  5. 2016975Family a.140.1.1: LEM domain [63452] (2 proteins)
  6. 2016981Protein Thymopoietin, LAP2 [63453] (1 species)
  7. 2016982Species Human (Homo sapiens) [TaxId:9606] [63454] (3 PDB entries)
  8. 2016984Domain d1gjja2: 1gjj A:111-153 [83292]
    the two domain structures are superimposed on each other

Details for d1gjja2

PDB Entry: 1gjj (more details)

PDB Description: n-terminal constant region of the nuclear envelope protein lap2
PDB Compounds: (A:) lap2

SCOPe Domain Sequences for d1gjja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gjja2 a.140.1.1 (A:111-153) Thymopoietin, LAP2 {Human (Homo sapiens) [TaxId: 9606]}
dvteltnedlldqlvkygvnpgpivgttrklyekkllklreqg

SCOPe Domain Coordinates for d1gjja2:

Click to download the PDB-style file with coordinates for d1gjja2.
(The format of our PDB-style files is described here.)

Timeline for d1gjja2:

2016984
d1gjja2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1gjja1