Lineage for d1fb9a_ (1fb9 A:)

  1. Root: SCOPe 2.04
  2. 1713148Class j: Peptides [58231] (126 folds)
  3. 1713367Fold j.6: Peptide hormones [58283] (1 superfamily)
    contains one alpha-helix
  4. 1713368Superfamily j.6.1: Peptide hormones [58284] (1 family) (S)
    this is not a true superfamily
  5. 1713369Family j.6.1.1: Peptide hormones [58285] (19 proteins)
  6. 1713370Protein Calcitonin [58301] (3 species)
  7. 1713378Species Pink salmon (Oncorhynchus gorbuscha) [TaxId:8017] [90268] (1 PDB entry)
  8. 1713379Domain d1fb9a_: 1fb9 A: [83250]

Details for d1fb9a_

PDB Entry: 1fb9 (more details)

PDB Description: effects of s-sulfonation on the solution structure of salmon calcitonin
PDB Compounds: (A:) calcitonin analogue

SCOPe Domain Sequences for d1fb9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fb9a_ j.6.1.1 (A:) Calcitonin {Pink salmon (Oncorhynchus gorbuscha) [TaxId: 8017]}
csnlstcvlgklsqelhklqtyprtntgsgtp

SCOPe Domain Coordinates for d1fb9a_:

Click to download the PDB-style file with coordinates for d1fb9a_.
(The format of our PDB-style files is described here.)

Timeline for d1fb9a_: