Lineage for d1c81a_ (1c81 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890965Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2890966Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2891198Family c.60.1.4: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain [53267] (1 protein)
  6. 2891199Protein 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain [53268] (2 species)
    bifunctional enzyme
  7. 2891203Species Norway rat (Rattus norvegicus) [TaxId:10116] [53269] (8 PDB entries)
  8. 2891216Domain d1c81a_: 1c81 A: [83164]
    complexed with fdq

Details for d1c81a_

PDB Entry: 1c81 (more details), 2.5 Å

PDB Description: michaelis complex of fructose-2,6-bisphosphatase
PDB Compounds: (A:) fructose-2,6-bisphosphatase

SCOPe Domain Sequences for d1c81a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c81a_ c.60.1.4 (A:) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mrsiylcrhgeselnlrgriggdsglsargkqyayalanfirsqgisslkvwtshmkrti
qtaealgvpyeqwkalneidagvceemtyeeiqehypeefalrdqdkyryrypkgesyed
lvqrlepvimelerqenvlvichqavmrcllayfldkssdelpylkcplhtvlkltpvay
gcrvesiylnv

SCOPe Domain Coordinates for d1c81a_:

Click to download the PDB-style file with coordinates for d1c81a_.
(The format of our PDB-style files is described here.)

Timeline for d1c81a_: