PDB entry 1c81

View 1c81 on RCSB PDB site
Description: michaelis complex of fructose-2,6-bisphosphatase
Class: hydrolase
Keywords: Rossmann fold, HYDROLASE
Deposited on 2000-04-03, released 2003-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fructose-2,6-bisphosphatase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07953 (1-190)
      • initiating met (0)
    Domains in SCOPe 2.08: d1c81a_
  • Heterogens: FDQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c81A (A:)
    mrsiylcrhgeselnlrgriggdsglsargkqyayalanfirsqgisslkvwtshmkrti
    qtaealgvpyeqwkalneidagvceemtyeeiqehypeefalrdqdkyryrypkgesyed
    lvqrlepvimelerqenvlvichqavmrcllayfldkssdelpylkcplhtvlkltpvay
    gcrvesiylnv