Lineage for d1ku2b2 (1ku2 B:93-272)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 927308Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
    multihelical; consists of a conserved 4-helical core and a variable insert subdomain
  4. 927309Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (1 family) (S)
  5. 927310Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (5 proteins)
  6. 927311Protein Sigma factor SigA [88950] (1 species)
  7. 927312Species Thermus aquaticus [TaxId:271] [88951] (1 PDB entry)
  8. 927314Domain d1ku2b2: 1ku2 B:93-272 [83099]
    Other proteins in same PDB: d1ku2a1, d1ku2b1
    complexed with so4

Details for d1ku2b2

PDB Entry: 1ku2 (more details), 2.9 Å

PDB Description: Crystal Structure of Thermus aquaticus RNA Polymerase Sigma Subunit Fragment Containing Regions 1.2 to 3.1
PDB Compounds: (B:) sigma factor sigA

SCOPe Domain Sequences for d1ku2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ku2b2 a.177.1.1 (B:93-272) Sigma factor SigA {Thermus aquaticus [TaxId: 271]}
sdpvrqylheigqvplltleeeidlarkveegmeaikklseatgldqelirevvrakilg
tariqkipglkekpdpktveevdgklkslpkelkrylhiaregeaarqhlieanlrlvvs
iakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiadqart

SCOPe Domain Coordinates for d1ku2b2:

Click to download the PDB-style file with coordinates for d1ku2b2.
(The format of our PDB-style files is described here.)

Timeline for d1ku2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ku2b1