SCOPe 2.06: Domain d1h2ha4: 1h2h A:1-108,A:220-241

Lineage for d1h2ha4 (1h2h A:1-108,A:220-241)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Hypothetical protein TM1643 [75108] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [75109] (2 PDB entries)

8. Domain d1h2ha4: 1h2h A:1-108,A:220-241 [83058]
   Other proteins in same PDB: d1h2ha3
   complexed with nad

Details for d1h2ha4

PDB Entry: 1h2h, 2.6 Å

PDB Description: crystal structure of tm1643

PDB Compounds: (A:) hypothetical protein tm1643

SCOPe Domain Sequences for d1h2ha4:

Sequence; same for both SEQRES and ATOM records:

>d1h2ha4 c.2.1.3 (A:1-108,A:220-241) Hypothetical protein TM1643 {Thermotoga maritima [TaxId: 2336]}
mtvliigmgnigkklvelgnfekiyaydriskdipgvvrldefqvpsdvstvvecaspea
vkeyslqilknpvnyiiistsafadevfrerffselknsparvffpsgXsmltvysilrt
lrnleskiifg

Timeline for d1h2ha4:

• d1h2ha4 first appeared in SCOP 1.65
  
• d1h2ha4 appears in SCOPe 2.05
  
• d1h2ha4 appears in SCOPe 2.07
  
• d1h2ha4 appears in the current release, SCOPe 2.08