Lineage for d1fpn.1 (1fpn 4:,2:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1141359Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1141532Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 1141533Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 1141651Protein Rhinovirus coat proteins [49670] (5 species)
  7. 1141697Species Human rhinovirus A 2 (HRV-2) [TaxId:12130] [49674] (2 PDB entries)
  8. 1141698Domain d1fpn.1: 1fpn 4:,2: [83053]
    complexed with dao

Details for d1fpn.1

PDB Entry: 1fpn (more details), 2.6 Å

PDB Description: human rhinovirus serotype 2 (hrv2)
PDB Compounds: (2:) coat protein vp2, (4:) coat protein vp4

SCOPe Domain Sequences for d1fpn.1:

Sequence, based on SEQRES records: (download)

>g1fpn.1 b.121.4.1 (4:,2:) Rhinovirus coat proteins {Human rhinovirus A 2 (HRV-2) [TaxId: 12130]}
aqvsrqnvgthstqnsvsngsslnyfninyfkdaasngasklXriiqitrgdstitsqdv
anaivaygvwphylsskdasaidkpsqpdtssnrfytlrsvtwsssskgwwwklpdalkd
mgifgenmfyhylgrsgytihvqcnaskfhqgtlivalipehqiasalhgnvnvgynyth
pgetgrevkaetrlnpdlqpteeywlnfdgtllgnitifphqfinlrsnnsatiiapyvn
avpmdsmrshnnwslviipicpletssaintipitisispmcaefsgarakrq

Sequence, based on observed residues (ATOM records): (download)

>g1fpn.1 b.121.4.1 (4:,2:) Rhinovirus coat proteins {Human rhinovirus A 2 (HRV-2) [TaxId: 12130]}
aqvsrqnyfninyfkdaasngasklXriiqitrgdstitsqdvanaivaygvwphylssk
dasaidkpsqpdtssnrfytlrsvtwsssskgwwwklpdalkdmgifgenmfyhylgrsg
ytihvqcnaskfhqgtlivalipehqiasalhgnvnvgynythpgetgrevkaetrlnpd
lqpteeywlnfdgtllgnitifphqfinlrsnnsatiiapyvnavpmdsmrshnnwslvi
ipicpletssaintipitisispmcaefsgarakrq

SCOPe Domain Coordinates for d1fpn.1:

Click to download the PDB-style file with coordinates for d1fpn.1.
(The format of our PDB-style files is described here.)

Timeline for d1fpn.1: