SCOPe 2.01: Domain d1bmv11: 1bmv 1:1001-1185

Lineage for d1bmv11 (1bmv 1:1001-1185)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.2: Comoviridae-like VP [88636] (2 proteins)
   duplication: mature coat protein consists of three similar domains that can be in a single chain or in two separate chains

6. Protein Comovirus coat proteins (VP37 and VP23) [49627] (2 species)
   chain 1 is one-domain VP23; chain 2 is two-domain VP37

7. Species BPMV (Bean pod mottle virus) [TaxId:12260] [49628] (3 PDB entries)

8. Domain d1bmv11: 1bmv 1:1001-1185 [83041]
   protein/RNA complex

Details for d1bmv11

PDB Entry: 1bmv, 3 Å

PDB Description: protein-rna interactions in an icosahedral virus at 3.0 angstroms resolution

PDB Compounds: (1:) protein (icosahedral virus - a domain)

SCOPe Domain Sequences for d1bmv11:

Sequence; same for both SEQRES and ATOM records:

>d1bmv11 b.121.4.2 (1:1001-1185) Comovirus coat proteins (VP37 and VP23) {BPMV (Bean pod mottle virus) [TaxId: 12260]}
sisqqtvwnqmatvrtplnfdsskqsfcqfsvdllgggisvdktgdwitlvqnspisnll
rvaawkkgclmvkvvmsgnaavkrsdwaslvqvfltnsnstehfdacrwtksephsweli
fpievcgpnngfemwssewanqtswhlsflvdnpkqsttfdvllgisqnfeiagntlmpa
fsvpq

Timeline for d1bmv11:

• d1bmv11 first appeared in SCOP 1.65
  
• d1bmv11 appears in SCOP 1.75
  
• d1bmv11 appears in SCOPe 2.02
  
• d1bmv11 appears in the current release, SCOPe 2.08