SCOPe 2.06: Domain d1qicb_: 1qic B:

Lineage for d1qicb_ (1qic B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Stromelysin-1 (MMP-3) [55536] (1 species)

7. Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (40 PDB entries)

8. Domain d1qicb_: 1qic B: [81263]
   complexed with ca, zn

Details for d1qicb_

PDB Entry: 1qic, 2 Å

PDB Description: crystal structure of stromelysin catalytic domain

PDB Compounds: (B:) protein (stromelysin-1)

SCOPe Domain Sequences for d1qicb_:

Sequence; same for both SEQRES and ATOM records:

>d1qicb_ d.92.1.11 (B:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
ipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadimisfav
rehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaaheighslg
lfhsantealmyplyhsltdltrfrlsqddingiqslygpp

Timeline for d1qicb_:

• d1qicb_ first appeared in SCOP 1.63
  
• d1qicb_ appears in SCOPe 2.05
  
• d1qicb_ appears in SCOPe 2.07
  
• d1qicb_ appears in the current release, SCOPe 2.08