Lineage for d1o9lc2 (1o9l C:300-520)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 318249Fold c.63: CoA transferase [53315] (1 superfamily)
    core: 3 layers: a/b/a; beta-sheet of 7 strands, order 4321567; part of sheet is folded upon itself and forms a barrel-like structure
  4. 318250Superfamily c.63.1: CoA transferase [53316] (2 families) (S)
  5. 318270Family c.63.1.3: beta subunit-like [74657] (2 proteins)
    mixed beta-sheet; strand 3 is antiparallel to the rest
  6. 318275Protein Succinate:CoA transferase, C-terminal domain [82466] (1 species)
  7. 318276Species Pig (Sus scrofa) [TaxId:9823] [82467] (2 PDB entries)
  8. 318283Domain d1o9lc2: 1o9l C:300-520 [81246]
    Other proteins in same PDB: d1o9la1, d1o9lb1, d1o9lc1, d1o9ld1

Details for d1o9lc2

PDB Entry: 1o9l (more details), 2.4 Å

PDB Description: succinate:coenzyme-a transferase (pig heart)

SCOP Domain Sequences for d1o9lc2:

Sequence, based on SEQRES records: (download)

>d1o9lc2 c.63.1.3 (C:300-520) Succinate:CoA transferase, C-terminal domain {Pig (Sus scrofa)}
nvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpyplqnev
dadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlanwmipgkl
vkgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriitekavfdvd
rkkgltlielwegltvddikkstgcdfavspklipmqqvtt

Sequence, based on observed residues (ATOM records): (download)

>d1o9lc2 c.63.1.3 (C:300-520) Succinate:CoA transferase, C-terminal domain {Pig (Sus scrofa)}
nvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpyplqnev
dadlinagketvtvlpgasyfssdesfamirgghvnltmlgvkgmggamdlvssaktkvv
vtmcvnriitekavfdvdrkkgltlielwegltvddikkstgcdfavspklipmqqvtt

SCOP Domain Coordinates for d1o9lc2:

Click to download the PDB-style file with coordinates for d1o9lc2.
(The format of our PDB-style files is described here.)

Timeline for d1o9lc2: