Lineage for d1o9lc1 (1o9l C:40-285)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 318249Fold c.63: CoA transferase [53315] (1 superfamily)
    core: 3 layers: a/b/a; beta-sheet of 7 strands, order 4321567; part of sheet is folded upon itself and forms a barrel-like structure
  4. 318250Superfamily c.63.1: CoA transferase [53316] (2 families) (S)
  5. 318251Family c.63.1.2: alpha subunit-like [74656] (3 proteins)
    parallel beta-sheet
  6. 318260Protein Succinate:CoA transferase, N-terminal domain [82464] (1 species)
  7. 318261Species Pig (Sus scrofa) [TaxId:9823] [82465] (2 PDB entries)
  8. 318268Domain d1o9lc1: 1o9l C:40-285 [81245]
    Other proteins in same PDB: d1o9la2, d1o9lb2, d1o9lc2, d1o9ld2

Details for d1o9lc1

PDB Entry: 1o9l (more details), 2.4 Å

PDB Description: succinate:coenzyme-a transferase (pig heart)

SCOP Domain Sequences for d1o9lc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o9lc1 c.63.1.2 (C:40-285) Succinate:CoA transferase, N-terminal domain {Pig (Sus scrofa)}
tkfytdaveavkdipngatvlvggfglcgipenligallktgvkeltavsnnagvdnfgl
glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag
nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri
erlsvr

SCOP Domain Coordinates for d1o9lc1:

Click to download the PDB-style file with coordinates for d1o9lc1.
(The format of our PDB-style files is described here.)

Timeline for d1o9lc1: