| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
| Family c.26.2.3: ETFP subunits [52432] (3 proteins) alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet |
| Protein Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain [81393] (3 species) contains an additional FAD-binding domain of DHS-like fold |
| Species Methylophilus methylotrophus [TaxId:17] [82362] (8 PDB entries) |
| Domain d1o97d1: 1o97 D:1-192 [81233] Other proteins in same PDB: d1o97c_, d1o97d2 complexed with amp, fad |
PDB Entry: 1o97 (more details), 1.6 Å
SCOPe Domain Sequences for d1o97d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o97d1 c.26.2.3 (D:1-192) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Methylophilus methylotrophus [TaxId: 17]}
skilviaehrrndlrpvsleligaanglkksgedkvvvavigsqadafvpalsvngvdel
vvvkgssidfdpdvfeasvsaliaahnpsvvllphsvdslgyasslasktgygfatdvyi
veyqgdelvatrggynqkvnvevdfpgkstvvltirpsvfkplegagspvvsnvdapsvq
srsqnkdyvevg
Timeline for d1o97d1: