| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
| Family c.31.1.2: C-terminal domain of the electron transfer flavoprotein alpha subunit [52471] (1 protein) lacks strand 3; shares the FAD-binding mode with the pyruvate oxidase domain |
| Protein C-terminal domain of the electron transfer flavoprotein alpha subunit [52472] (3 species) |
| Species Methylophilus methylotrophus [TaxId:17] [82379] (6 PDB entries) |
| Domain d1o96f2: 1o96 F:196-318 [81228] Other proteins in same PDB: d1o96a_, d1o96b1, d1o96c_, d1o96d1, d1o96e_, d1o96f1, d1o96q_, d1o96z1 complexed with amp, fad |
PDB Entry: 1o96 (more details), 3.1 Å
SCOPe Domain Sequences for d1o96f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o96f2 c.31.1.2 (F:196-318) C-terminal domain of the electron transfer flavoprotein alpha subunit {Methylophilus methylotrophus [TaxId: 17]}
didittvdfimsigrgigeetnveqfreladeagatlccsrpiadagwlpksrqvgqsgk
vvgscklyvamgisgsiqhmagmkhvptiiavntdpgasiftiakygivadifdieeelk
aql
Timeline for d1o96f2: