Lineage for d1o96b1 (1o96 B:1-191)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1842253Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 1842395Family c.26.2.3: ETFP subunits [52432] (3 proteins)
    alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet
  6. 1842396Protein Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain [81393] (3 species)
    contains an additional FAD-binding domain of DHS-like fold
  7. 1842400Species Methylophilus methylotrophus [TaxId:17] [82362] (8 PDB entries)
  8. 1842408Domain d1o96b1: 1o96 B:1-191 [81221]
    Other proteins in same PDB: d1o96a_, d1o96b2, d1o96c_, d1o96d2, d1o96e_, d1o96f2, d1o96q_, d1o96z2
    complexed with amp, fad

Details for d1o96b1

PDB Entry: 1o96 (more details), 3.1 Å

PDB Description: structure of electron transferring flavoprotein for methylophilus methylotrophus.
PDB Compounds: (B:) electron transferring flavoprotein alpha-subunit

SCOPe Domain Sequences for d1o96b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o96b1 c.26.2.3 (B:1-191) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Methylophilus methylotrophus [TaxId: 17]}
skilviaehrrndlrpvsleligaanglkksgedkvvvavigsqadafvpalsvngvdel
vvvkgssidfdpdvfeasvsaliaahnpsvvllphsvdslgyasslasktgygfatdvyi
veyqgdelvatrggynqkvnvevdfpgkstvvltirpsvfkplegagspvvsnvdapsvq
srsqnkdyvev

SCOPe Domain Coordinates for d1o96b1:

Click to download the PDB-style file with coordinates for d1o96b1.
(The format of our PDB-style files is described here.)

Timeline for d1o96b1: