SCOPe 2.08: Domain d1o75a1: 1o75 A:207-332

Lineage for d1o75a1 (1o75 A:207-332)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.20: Tp47 lipoprotein, middle and C-terminal domains [81986] (1 family)

5. Family b.1.20.1: Tp47 lipoprotein, middle and C-terminal domains [81987] (1 protein)
   contains two different domains of immunoglobulin-like fold

6. Protein Tp47 lipoprotein, middle and C-terminal domains [81988] (1 species)
   a penicillin-binding protein with carboxypeptidase activity

7. Species Treponema pallidum [TaxId:160] [81989] (1 PDB entry)

8. Domain d1o75a1: 1o75 A:207-332 [81117]
   Other proteins in same PDB: d1o75a3, d1o75b3
   complexed with xe

Details for d1o75a1

PDB Entry: 1o75, 1.95 Å

PDB Description: tp47, the 47-kilodalton lipoprotein of treponema pallidum

PDB Compounds: (A:) 47 kda membrane antigen

SCOPe Domain Sequences for d1o75a1:

Sequence; same for both SEQRES and ATOM records:

>d1o75a1 b.1.20.1 (A:207-332) Tp47 lipoprotein, middle and C-terminal domains {Treponema pallidum [TaxId: 160]}
esphdlvvdtvgtgyhsrfgsdaeasvmlkradgselshrefidyvmnfntvrydyygdd
asytnlmasygtkhsadswwktgrvpriscginygfdrfkgsgpgyyrltliangyrdvv
advrfl

Timeline for d1o75a1:

• d1o75a1 first appeared in SCOP 1.63
  
• d1o75a1 appears in SCOPe 2.07