Lineage for d1o75b3 (1o75 B:7-206)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075410Fold b.120: Tp47 lipoprotein, N-terminal domain [82219] (1 superfamily)
    complex fold; consists of two intertwined subdomains
  4. 2075411Superfamily b.120.1: Tp47 lipoprotein, N-terminal domain [82220] (1 family) (S)
  5. 2075412Family b.120.1.1: Tp47 lipoprotein, N-terminal domain [82221] (1 protein)
  6. 2075413Protein Tp47 lipoprotein, N-terminal domain [82222] (1 species)
    a penicillin-binding protein with carboxypeptidase activity
  7. 2075414Species Treponema pallidum [TaxId:160] [82223] (1 PDB entry)
  8. 2075416Domain d1o75b3: 1o75 B:7-206 [81122]
    Other proteins in same PDB: d1o75a1, d1o75a2, d1o75b1, d1o75b2
    complexed with pdx, xe

Details for d1o75b3

PDB Entry: 1o75 (more details), 1.95 Å

PDB Description: tp47, the 47-kilodalton lipoprotein of treponema pallidum
PDB Compounds: (B:) 47 kda membrane antigen

SCOPe Domain Sequences for d1o75b3:

Sequence, based on SEQRES records: (download)

>d1o75b3 b.120.1.1 (B:7-206) Tp47 lipoprotein, N-terminal domain {Treponema pallidum [TaxId: 160]}
etsygyatlsyadywagelgqsrdvllagnaeadragdldagmfdavsrathghgafrqq
fqyavevlgekvlskqetedsrgrkkweyetdpsvtkmvrasasfqdlgedgeikfeave
gavaladrassfmvdseeykitnvkvhgmkfvpvavphelkgiakekfhfvedsrvtent
nglktmltedsfsarkvssm

Sequence, based on observed residues (ATOM records): (download)

>d1o75b3 b.120.1.1 (B:7-206) Tp47 lipoprotein, N-terminal domain {Treponema pallidum [TaxId: 160]}
etsygyatlsyadywagelgqsrdvlladragdldagmfdavsrathghgafrqqfqyav
evlgekvlskqetedsrgrkkweyetdpsvtkmvrasasfqdlgedgeikfeavegaval
adrassfmvdseeykitnvkvhgmkfvpvavphelkgiakekfhfvedsrvtentnglkt
mltedsfsarkvssm

SCOPe Domain Coordinates for d1o75b3:

Click to download the PDB-style file with coordinates for d1o75b3.
(The format of our PDB-style files is described here.)

Timeline for d1o75b3: