![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
![]() | Superfamily c.10.2: L domain-like [52058] (9 families) ![]() less regular structure consisting of variable repeats |
![]() | Family c.10.2.1: Internalin LRR domain [52059] (4 proteins) capped at the N-end with a truncated EF-hand subdomain this is a repeat family; one repeat unit is 2omx A:261-239 found in domain |
![]() | Protein Internalin A [82324] (1 species) |
![]() | Species Listeria monocytogenes [TaxId:1639] [82325] (10 PDB entries) |
![]() | Domain d1o6ta2: 1o6t A:36-416 [81098] Other proteins in same PDB: d1o6ta1, d1o6ta3 complexed with ca, cl, mes, mg, so4 applies to all domains of a family if the common domain is composed of a different number of small repeating units |
PDB Entry: 1o6t (more details), 1.6 Å
SCOPe Domain Sequences for d1o6ta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o6ta2 c.10.2.1 (A:36-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} atitqdtpinqiftdtalaekmktvlgktnvtdtvsqtdldqvttlqadrlgiksidgve ylnnltqinfsnnqltditplknltklvdilmnnnqiaditplanltnltgltlfnnqit didplknltnlnrlelssntisdisalsgltslqqlsfgnqvtdlkplanlttlerldis snkvsdisvlakltnlesliatnnqisditplgiltnldelslngnqlkdigtlasltnl tdldlannqisnlaplsgltkltelklganqisnisplagltaltnlelnenqledispi snlknltyltlyfnnisdispvssltklqrlffynnkvsdvsslanltninwlsaghnqi sdltplanltritqlglndqa
Timeline for d1o6ta2: