SCOPe 2.06: Domain d1o6eb_: 1o6e B:

Lineage for d1o6eb_ (1o6e B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.57: Herpes virus serine proteinase, assemblin [50788] (1 superfamily)
   core: barrel, closed; n=7, S=8; complex topology

4. Superfamily b.57.1: Herpes virus serine proteinase, assemblin [50789] (2 families)
   automatically mapped to Pfam PF00716

5. Family b.57.1.1: Herpes virus serine proteinase, assemblin [50790] (5 proteins)

6. Protein Epstein-Barr virus protease [82149] (1 species)

7. Species Human herpesvirus 4 [TaxId:10376] [82150] (1 PDB entry)

8. Domain d1o6eb_: 1o6e B: [81084]
   complexed with isp

Details for d1o6eb_

PDB Entry: 1o6e, 2.3 Å

PDB Description: epstein-barr virus protease

PDB Compounds: (B:) Capsid protein P40

SCOPe Domain Sequences for d1o6eb_:

Sequence; same for both SEQRES and ATOM records:

>d1o6eb_ b.57.1.1 (B:) Epstein-Barr virus protease {Human herpesvirus 4 [TaxId: 10376]}
apsvyvcgfverpdappkdaclhldpltvksqlplkkplpltvehlpdapvgsvfglyqs
saglfsaasitsgdflslldsiyhdcdiaqsqrlplprepkvealhawlpslslaslhpd
ipqttadggklsffdhvsicalgrrrgttavygtdlawvlkhfsdlepsiaaqiendana
akresgcpedhplpltkliakaidagflrnrvetlrqdrgvanipaesylka

Timeline for d1o6eb_:

• d1o6eb_ first appeared in SCOP 1.63
  
• d1o6eb_ appears in SCOPe 2.05
  
• d1o6eb_ appears in SCOPe 2.07
  
• d1o6eb_ appears in the current release, SCOPe 2.08