![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.15: Muscle protein complexes [64616] (1 superfamily) |
![]() | Superfamily i.15.1: Muscle protein complexes [64617] (1 family) ![]() |
![]() | Family i.15.1.1: Muscle protein complexes [64618] (3 proteins) |
![]() | Protein Averaged rigor crossbridges from tomograms of insect flight muscle [82952] (1 species) |
![]() | Species Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId:9031] [82953] (11 PDB entries) |
![]() | Domain d1o1gq_: 1o1g Q: [81037] |
PDB Entry: 1o1g (more details), 70 Å
SCOPe Domain Sequences for d1o1gq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o1gq_ i.15.1.1 (Q:) Averaged rigor crossbridges from tomograms of insect flight muscle {Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId: 9031]} fdeteiedfkeaftvidqnadgiidkddlretfaamgrlnvkneeldamikeasgpinft vfltmfgeklkgadpedvimgafkvldpdgkgsikksfleellttgggrftpeeiknmwa afppdvagnvdyknicyvithgeda
Timeline for d1o1gq_:
![]() Domains from other chains: (mouse over for more information) d1o1g1_, d1o1g2_, d1o1g3_, d1o1g4_, d1o1g5_, d1o1g6_, d1o1g7_, d1o1g8_, d1o1g9_, d1o1ga_, d1o1gb_, d1o1gc_, d1o1gd_, d1o1ge_, d1o1gf_, d1o1gg_, d1o1gh_, d1o1gi_, d1o1gj_, d1o1gk_, d1o1gl_, d1o1gm_, d1o1gn_, d1o1go_, d1o1gp_, d1o1gr_, d1o1gv_, d1o1gw_, d1o1gx_, d1o1gy_, d1o1gz_ |