|  | Class i: Low resolution protein structures [58117] (18 folds) | 
|  | Fold i.15: Muscle protein complexes [64616] (1 superfamily) | 
|  | Superfamily i.15.1: Muscle protein complexes [64617] (1 family)  | 
|  | Family i.15.1.1: Muscle protein complexes [64618] (2 proteins) | 
|  | Protein Averaged rigor crossbridges from tomograms of insect flight muscle [82952] (1 species) | 
|  | Species Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId:9031] [82953] (11 PDB entries) | 
|  | Domain d1o1fb_: 1o1f B: [80996] | 
PDB Entry: 1o1f (more details)
SCOP Domain Sequences for d1o1fb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o1fb_ i.15.1.1 (B:) Averaged rigor crossbridges from tomograms of insect flight muscle {Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus)}
fdeteiedfkeaftvidqnadgiidkddlretfaamgrlnvkneeldamikeasgpinft
vfltmfgeklkgadpedvimgafkvldpdgkgsikksfleellttgggrftpeeiknmwa
afppdvagnvdyknicyvithgeda
Timeline for d1o1fb_: