![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.15: Muscle protein complexes [64616] (1 superfamily) |
![]() | Superfamily i.15.1: Muscle protein complexes [64617] (1 family) ![]() |
![]() | Family i.15.1.1: Muscle protein complexes [64618] (3 proteins) |
![]() | Protein Averaged rigor crossbridges from tomograms of insect flight muscle [82952] (1 species) |
![]() | Species Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId:9031] [82953] (11 PDB entries) |
![]() | Domain d1o1eq_: 1o1e Q: [80979] |
PDB Entry: 1o1e (more details), 70 Å
SCOPe Domain Sequences for d1o1eq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o1eq_ i.15.1.1 (Q:) Averaged rigor crossbridges from tomograms of insect flight muscle {Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId: 9031]} fdeteiedfkeaftvidqnadgiidkddlretfaamgrlnvkneeldamikeasgpinft vfltmfgeklkgadpedvimgafkvldpdgkgsikksfleellttgggrftpeeiknmwa afppdvagnvdyknicyvithgeda
Timeline for d1o1eq_:
![]() Domains from other chains: (mouse over for more information) d1o1e1_, d1o1e2_, d1o1e3_, d1o1e4_, d1o1e5_, d1o1e6_, d1o1e7_, d1o1e8_, d1o1e9_, d1o1ea_, d1o1eb_, d1o1ec_, d1o1ed_, d1o1ee_, d1o1ef_, d1o1eg_, d1o1eh_, d1o1ei_, d1o1ej_, d1o1ek_, d1o1el_, d1o1em_, d1o1en_, d1o1eo_, d1o1ep_, d1o1er_, d1o1ev_, d1o1ew_, d1o1ex_, d1o1ey_, d1o1ez_ |