|  | Class i: Low resolution protein structures [58117] (18 folds) | 
|  | Fold i.15: Muscle protein complexes [64616] (1 superfamily) | 
|  | Superfamily i.15.1: Muscle protein complexes [64617] (1 family)  | 
|  | Family i.15.1.1: Muscle protein complexes [64618] (2 proteins) | 
|  | Protein Averaged rigor crossbridges from tomograms of insect flight muscle [82952] (1 species) | 
|  | Species Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId:9031] [82953] (11 PDB entries) | 
|  | Domain d1o1eo_: 1o1e O: [80977] | 
PDB Entry: 1o1e (more details)
SCOP Domain Sequences for d1o1eo_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o1eo_ i.15.1.1 (O:) Averaged rigor crossbridges from tomograms of insect flight muscle {Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus)}
skaaaddfkeafllfdrtgdakitasqvgdiaralgqnptnaeinkilgnpskeemnaaa
itfeeflpmlqaaannkdqgtfedfveglrvfdkegngtvmgaelrhvlatlgekmteee
veelmkgqedsngcinyeafvkhimsv
Timeline for d1o1eo_:
|  View in 3D Domains from other chains: (mouse over for more information) d1o1e1_, d1o1e2_, d1o1e3_, d1o1e4_, d1o1e5_, d1o1e6_, d1o1e7_, d1o1e8_, d1o1e9_, d1o1ea_, d1o1eb_, d1o1ec_, d1o1ed_, d1o1ee_, d1o1ef_, d1o1eg_, d1o1eh_, d1o1ei_, d1o1ej_, d1o1ek_, d1o1el_, d1o1em_, d1o1en_, d1o1ep_, d1o1eq_, d1o1er_, d1o1ev_, d1o1ew_, d1o1ex_, d1o1ey_, d1o1ez_ |