Lineage for d1o1de_ (1o1d E:)

  1. Root: SCOPe 2.02
  2. 1248417Class i: Low resolution protein structures [58117] (25 folds)
  3. 1250498Fold i.15: Muscle protein complexes [64616] (1 superfamily)
  4. 1250499Superfamily i.15.1: Muscle protein complexes [64617] (1 family) (S)
  5. 1250500Family i.15.1.1: Muscle protein complexes [64618] (3 proteins)
  6. 1250505Protein Averaged rigor crossbridges from tomograms of insect flight muscle [82952] (1 species)
  7. 1250506Species Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId:9031] [82953] (11 PDB entries)
  8. 1250723Domain d1o1de_: 1o1d E: [80935]

Details for d1o1de_

PDB Entry: 1o1d (more details), 70 Å

PDB Description: molecular models of averaged rigor crossbridges from tomograms of insect flight muscle
PDB Compounds: (E:) Skeletal muscle Myosin II Regulatory Light Chain

SCOPe Domain Sequences for d1o1de_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o1de_ i.15.1.1 (E:) Averaged rigor crossbridges from tomograms of insect flight muscle {Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId: 9031]}
fdeteiedfkeaftvidqnadgiidkddlretfaamgrlnvkneeldamikeasgpinft
vfltmfgeklkgadpedvimgafkvldpdgkgsikksfleellttgggrftpeeiknmwa
afppdvagnvdyknicyvithgeda

SCOPe Domain Coordinates for d1o1de_:

Click to download the PDB-style file with coordinates for d1o1de_.
(The format of our PDB-style files is described here.)

Timeline for d1o1de_: