![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.15: Muscle protein complexes [64616] (1 superfamily) |
![]() | Superfamily i.15.1: Muscle protein complexes [64617] (1 family) ![]() |
![]() | Family i.15.1.1: Muscle protein complexes [64618] (3 proteins) |
![]() | Protein Averaged rigor crossbridges from tomograms of insect flight muscle [82952] (1 species) |
![]() | Species Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId:9031] [82953] (11 PDB entries) |
![]() | Domain d1o1bf_: 1o1b F: [80881] |
PDB Entry: 1o1b (more details), 70 Å
SCOPe Domain Sequences for d1o1bf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o1bf_ i.15.1.1 (F:) Averaged rigor crossbridges from tomograms of insect flight muscle {Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId: 9031]} skaaaddfkeafllfdrtgdakitasqvgdiaralgqnptnaeinkilgnpskeemnaaa itfeeflpmlqaaannkdqgtfedfveglrvfdkegngtvmgaelrhvlatlgekmteee veelmkgqedsngcinyeafvkhimsv
Timeline for d1o1bf_: