![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.15: Muscle protein complexes [64616] (1 superfamily) |
![]() | Superfamily i.15.1: Muscle protein complexes [64617] (1 family) ![]() |
![]() | Family i.15.1.1: Muscle protein complexes [64618] (3 proteins) |
![]() | Protein Averaged rigor crossbridges from tomograms of insect flight muscle [82952] (1 species) |
![]() | Species Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId:9031] [82953] (11 PDB entries) |
![]() | Domain d1o1an_: 1o1a N: [80857] |
PDB Entry: 1o1a (more details), 70 Å
SCOPe Domain Sequences for d1o1an_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o1an_ i.15.1.1 (N:) Averaged rigor crossbridges from tomograms of insect flight muscle {Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId: 9031]} fdeteiedfkeaftvidqnadgiidkddlretfaamgrlnvkneeldamikeasgpinft vfltmfgeklkgadpedvimgafkvldpdgkgsikksfleellttgggrftpeeiknmwa afppdvagnvdyknicyvithgeda
Timeline for d1o1an_:
![]() Domains from other chains: (mouse over for more information) d1o1a1_, d1o1a2_, d1o1a3_, d1o1a4_, d1o1a5_, d1o1a6_, d1o1a7_, d1o1a8_, d1o1a9_, d1o1aa_, d1o1ab_, d1o1ac_, d1o1ad_, d1o1ae_, d1o1af_, d1o1ag_, d1o1ah_, d1o1ai_, d1o1aj_, d1o1ak_, d1o1al_, d1o1am_, d1o1ao_, d1o1ap_, d1o1aq_, d1o1ar_, d1o1av_, d1o1aw_, d1o1ax_, d1o1ay_, d1o1az_ |