Lineage for d1o19o_ (1o19 O:)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2649582Fold i.15: Muscle protein complexes [64616] (1 superfamily)
  4. 2649583Superfamily i.15.1: Muscle protein complexes [64617] (1 family) (S)
  5. 2649584Family i.15.1.1: Muscle protein complexes [64618] (3 proteins)
  6. 2649589Protein Averaged rigor crossbridges from tomograms of insect flight muscle [82952] (1 species)
  7. 2649590Species Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId:9031] [82953] (11 PDB entries)
  8. 2649849Domain d1o19o_: 1o19 O: [80826]

Details for d1o19o_

PDB Entry: 1o19 (more details), 70 Å

PDB Description: molecular models of averaged rigor crossbridges from tomograms of insect flight muscle
PDB Compounds: (O:) Skeletal muscle Myosin II Essential Light Chain

SCOPe Domain Sequences for d1o19o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o19o_ i.15.1.1 (O:) Averaged rigor crossbridges from tomograms of insect flight muscle {Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId: 9031]}
skaaaddfkeafllfdrtgdakitasqvgdiaralgqnptnaeinkilgnpskeemnaaa
itfeeflpmlqaaannkdqgtfedfveglrvfdkegngtvmgaelrhvlatlgekmteee
veelmkgqedsngcinyeafvkhimsv

SCOPe Domain Coordinates for d1o19o_:

Click to download the PDB-style file with coordinates for d1o19o_.
(The format of our PDB-style files is described here.)

Timeline for d1o19o_: