Class i: Low resolution protein structures [58117] (18 folds) |
Fold i.15: Muscle protein complexes [64616] (1 superfamily) |
Superfamily i.15.1: Muscle protein complexes [64617] (1 family) |
Family i.15.1.1: Muscle protein complexes [64618] (2 proteins) |
Protein Averaged rigor crossbridges from tomograms of insect flight muscle [82952] (1 species) |
Species Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId:9031] [82953] (11 PDB entries) |
Domain d1o18e_: 1o18 E: [80784] |
PDB Entry: 1o18 (more details)
SCOP Domain Sequences for d1o18e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o18e_ i.15.1.1 (E:) Averaged rigor crossbridges from tomograms of insect flight muscle {Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus)} fdeteiedfkeaftvidqnadgiidkddlretfaamgrlnvkneeldamikeasgpinft vfltmfgeklkgadpedvimgafkvldpdgkgsikksfleellttgggrftpeeiknmwa afppdvagnvdyknicyvithgeda
Timeline for d1o18e_:
View in 3D Domains from other chains: (mouse over for more information) d1o181_, d1o182_, d1o183_, d1o184_, d1o185_, d1o186_, d1o187_, d1o188_, d1o189_, d1o18a_, d1o18d_, d1o18f_, d1o18g_, d1o18h_, d1o18i_, d1o18j_, d1o18k_, d1o18l_, d1o18m_, d1o18n_, d1o18o_, d1o18p_, d1o18q_, d1o18r_, d1o18v_, d1o18w_, d1o18x_, d1o18y_, d1o18z_ |