Lineage for d1o0yb_ (1o0y B:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 237126Superfamily c.1.10: Aldolase [51569] (4 families) (S)
    Common fold covers whole protein structure
  5. 237127Family c.1.10.1: Class I aldolase [51570] (8 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 237128Protein Deoxyribose-phosphate aldolase DeoC [69394] (3 species)
  7. 237139Species Thermotoga maritima [TaxId:243274] [82270] (1 PDB entry)
    TM1559
  8. 237141Domain d1o0yb_: 1o0y B: [80757]
    CASP5
    structural genomics protein

Details for d1o0yb_

PDB Entry: 1o0y (more details), 1.9 Å

PDB Description: Crystal structure of Deoxyribose-phosphate aldolase (TM1559) from Thermotoga maritima at 1.9 A resolution

SCOP Domain Sequences for d1o0yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o0yb_ c.1.10.1 (B:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima}
hhhhmieyrieeavakyrefyefkpvresagiedvksaiehtnlkpfatpddikklclea
renrfhgvcvnpcyvklareelegtdvkvvtvvgfplganetrtkaheaifavesgadei
dmvinvgmlkakeweyvyedirsvvesvkgkvvkviietcyldteekiaacvisklagah
fvktstgfgtggataedvhlmkwivgdemgvkasggirtfedavkmimygadrigtssgv
kivqggeeryg

SCOP Domain Coordinates for d1o0yb_:

Click to download the PDB-style file with coordinates for d1o0yb_.
(The format of our PDB-style files is described here.)

Timeline for d1o0yb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1o0ya_