SCOP 1.69: Domain d1o0ya_: 1o0y A:

Lineage for d1o0ya_ (1o0y A:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (6 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (12 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Deoxyribose-phosphate aldolase DeoC [69394] (5 species)

7. Species Thermotoga maritima [TaxId:243274] [82270] (1 PDB entry)
   TM1559

8. Domain d1o0ya_: 1o0y A: [80756]

Details for d1o0ya_

PDB Entry: 1o0y, 1.9 Å

PDB Description: Crystal structure of Deoxyribose-phosphate aldolase (TM1559) from Thermotoga maritima at 1.9 A resolution

SCOP Domain Sequences for d1o0ya_:

Sequence; same for both SEQRES and ATOM records:

>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima}
hhhhmieyrieeavakyrefyefkpvresagiedvksaiehtnlkpfatpddikklclea
renrfhgvcvnpcyvklareelegtdvkvvtvvgfplganetrtkaheaifavesgadei
dmvinvgmlkakeweyvyedirsvvesvkgkvvkviietcyldteekiaacvisklagah
fvktstgfgtggataedvhlmkwivgdemgvkasggirtfedavkmimygadrigtssgv
kivqggeeryg

Timeline for d1o0ya_:

• d1o0ya_ first appeared in SCOP 1.63
  
• d1o0ya_ appears in SCOP 1.67
  
• d1o0ya_ appears in SCOP 1.71
  
• d1o0ya_ last appears in SCOP 1.75