![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
![]() | Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) ![]() automatically mapped to Pfam PF00875 |
![]() | Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (2 proteins) |
![]() | Protein Cryptochrome [82367] (3 species) |
![]() | Species Synechocystis sp. PCC 6803 [TaxId:1148] [82368] (1 PDB entry) |
![]() | Domain d1np7b2: 1np7 B:1-204 [80680] Other proteins in same PDB: d1np7a1, d1np7b1 complexed with fad, so4 |
PDB Entry: 1np7 (more details), 1.9 Å
SCOPe Domain Sequences for d1np7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1np7b2 c.28.1.1 (B:1-204) Cryptochrome {Synechocystis sp. PCC 6803 [TaxId: 1148]} mkhvpptvlvwfrndlrlhdheplhralksglaitavycydprqfaqthqgfaktgpwrs nflqqsvqnlaeslqkvgnkllvttglpeqvipqiakqinaktiyyhrevtqeeldvern lvkqltilgieakgywgstlchpedlpfsiqdlpdlftkfrkdiekkkisirpcffapsq llpspnikleltapppeffpqinf
Timeline for d1np7b2: