Lineage for d1np7a1 (1np7 A:205-483)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1093839Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 1093840Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (1 family) (S)
  5. 1093841Family a.99.1.1: Cryptochrome/photolyase FAD-binding domain [48174] (2 proteins)
  6. 1093863Protein Cryptochrome C-terminal domain [81841] (2 species)
  7. 1093864Species Synechocystis sp. PCC 6803 [TaxId:1148] [81842] (1 PDB entry)
  8. 1093865Domain d1np7a1: 1np7 A:205-483 [80677]
    Other proteins in same PDB: d1np7a2, d1np7b2
    complexed with fad, so4

Details for d1np7a1

PDB Entry: 1np7 (more details), 1.9 Å

PDB Description: Crystal Structure Analysis of Synechocystis sp. PCC6803 cryptochrome
PDB Compounds: (A:) DNA photolyase

SCOPe Domain Sequences for d1np7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1np7a1 a.99.1.1 (A:205-483) Cryptochrome C-terminal domain {Synechocystis sp. PCC 6803 [TaxId: 1148]}
dhrsvlafqggetaglarlqdyfwhgdrlkdyketrngmvgadysskfspwlalgclspr
fiyqevkryeqervsndsthwlifellwrdffrfvaqkygnklfnrggllnknfpwqedq
vrfelwrsgqtgyplvdanmrelnltgfmsnrgrqnvasflcknlgidwrwgaewfescl
idydvcsnwgnwnytagigndardfryfnipkqsqqydpqgtylrhwlpelknlpgdkih
qpwllsateqkqwgvqlgvdyprpcvnfhqsvearrkie

SCOPe Domain Coordinates for d1np7a1:

Click to download the PDB-style file with coordinates for d1np7a1.
(The format of our PDB-style files is described here.)

Timeline for d1np7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1np7a2