| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.3: L30e-like [55315] (4 families) ![]() |
| Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins) |
| Protein Eukaryotic ribosomal protein L30 (L30e) [55317] (2 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55318] (4 PDB entries) Uniprot P14120 |
| Domain d1nmud_: 1nmu D: [80668] Other proteins in same PDB: d1nmua1, d1nmua2, d1nmuc1, d1nmuc2 fusion protein with MBP |
PDB Entry: 1nmu (more details), 2.31 Å
SCOPe Domain Sequences for d1nmud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nmud_ d.79.3.1 (D:) Eukaryotic ribosomal protein L30 (L30e) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pvksqesinqklalviksgkytlgykstvkslrqgkskliiiaantpvlrkseleyyaml
sktkvyyfqggnnelgtavgklfrvgvvsileagdsdilttla
Timeline for d1nmud_: