Lineage for d1nmuc_ (1nmu C:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710610Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 710611Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 710612Family c.94.1.1: Phosphate binding protein-like [53851] (35 proteins)
  6. 710663Protein D-maltodextrin-binding protein, MBP [53862] (4 species)
    contains a few additional helices in the C-terminal extension; homologous to thiaminase I
  7. 710674Species Escherichia coli [TaxId:562] [53863] (45 PDB entries)
  8. 710729Domain d1nmuc_: 1nmu C: [80667]
    Other proteins in same PDB: d1nmub_, d1nmud_
    chimera with yeast L30e ribosomal protein
    complexed with mtt

Details for d1nmuc_

PDB Entry: 1nmu (more details), 2.31 Å

PDB Description: mbp-l30
PDB Compounds: (C:) Maltose-binding periplasmic protein

SCOP Domain Sequences for d1nmuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmuc_ c.94.1.1 (C:) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
eegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifw
ahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdll
pnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvg
vdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvny
gvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgav
alksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealk
daqtnsss

SCOP Domain Coordinates for d1nmuc_:

Click to download the PDB-style file with coordinates for d1nmuc_.
(The format of our PDB-style files is described here.)

Timeline for d1nmuc_: