Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (35 proteins) |
Protein D-maltodextrin-binding protein, MBP [53862] (4 species) contains a few additional helices in the C-terminal extension; homologous to thiaminase I |
Species Escherichia coli [TaxId:562] [53863] (45 PDB entries) |
Domain d1nmuc_: 1nmu C: [80667] Other proteins in same PDB: d1nmub_, d1nmud_ chimera with yeast L30e ribosomal protein complexed with mtt |
PDB Entry: 1nmu (more details), 2.31 Å
SCOP Domain Sequences for d1nmuc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nmuc_ c.94.1.1 (C:) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]} eegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifw ahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdll pnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvg vdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvny gvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgav alksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealk daqtnsss
Timeline for d1nmuc_: