| Class a: All alpha proteins [46456] (179 folds) |
| Fold a.38: Helix-loop-helix DNA-binding domain [47458] (1 superfamily) 4-helices; bundle, closed, left-handed twist; 2 crossover connections |
Superfamily a.38.1: Helix-loop-helix DNA-binding domain [47459] (1 family) ![]() dimer of two identical helix-loop-helix subunits |
| Family a.38.1.1: Helix-loop-helix DNA-binding domain [47460] (7 proteins) |
| Protein Max protein [47461] (2 species) BHLHZ region; contains leucine-zipper motif |
| Species Human (Homo sapiens) [TaxId:9606] [47462] (3 PDB entries) |
| Domain d1nlwe_: 1nlw E: [80636] Other proteins in same PDB: d1nlwa_, d1nlwd_ complexed with Mad |
PDB Entry: 1nlw (more details), 2 Å
SCOP Domain Sequences for d1nlwe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nlwe_ a.38.1.1 (E:) Max protein {Human (Homo sapiens)}
ahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhthqqdi
ddlkrqnalleqqv
Timeline for d1nlwe_: