Lineage for d1nlva2 (1nlv A:147-375)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2491251Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2491252Protein Actin [53073] (10 species)
  7. 2491518Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [53076] (7 PDB entries)
  8. 2491522Domain d1nlva2: 1nlv A:147-375 [80631]
    Other proteins in same PDB: d1nlvg_
    complexed with atp, ca, so2, so4

Details for d1nlva2

PDB Entry: 1nlv (more details), 1.8 Å

PDB Description: Crystal Structure Of Dictyostelium Discoideum Actin Complexed With Ca ATP And Human Gelsolin Segment 1
PDB Compounds: (A:) actin

SCOPe Domain Sequences for d1nlva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nlva2 c.55.1.1 (A:147-375) Actin {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
rttgivmdsgdgvshtvpiyegyalphailrldlagrdltdymmkiltergysftttaer
eivrdikeklayvaldfeqemataasssaleksyelpdgqvitignerfrcpealfqpsf
lgmesagihettynsimkcdvdirkdlygnvvlsggttmfpgiadrmnkeltalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskeeydesgpsivhrkcf

SCOPe Domain Coordinates for d1nlva2:

Click to download the PDB-style file with coordinates for d1nlva2.
(The format of our PDB-style files is described here.)

Timeline for d1nlva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nlva1
View in 3D
Domains from other chains:
(mouse over for more information)
d1nlvg_