![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.1: Actin/HSP70 [53068] (7 proteins) |
![]() | Protein Actin [53073] (6 species) |
![]() | Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [53076] (6 PDB entries) |
![]() | Domain d1nlva1: 1nlv A:4-146 [80630] Other proteins in same PDB: d1nlvg_ complexed with atp, ca, so2, so4 |
PDB Entry: 1nlv (more details), 1.8 Å
SCOPe Domain Sequences for d1nlva1:
Sequence, based on SEQRES records: (download)
>d1nlva1 c.55.1.1 (A:4-146) Actin {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} dvqalvidngsgmckagfagddapravfpsivgrprhtgvmvgmgqkdsyvgdeaqskrg iltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqim fetfntpamyvaiqavlslyasg
>d1nlva1 c.55.1.1 (A:4-146) Actin {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} dvqalvidngsgmckagfagddapravfpsivgrprhtkdsyvgdeaqskrgiltlkypi ehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntpa myvaiqavlslyasg
Timeline for d1nlva1: