Lineage for d1nkwz_ (1nkw Z:)

  1. Root: SCOP 1.73
  2. 753709Class i: Low resolution protein structures [58117] (26 folds)
  3. 753710Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 753711Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 754417Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 754418Protein 50S subunit [58125] (3 species)
  7. 754452Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)
  8. 754484Domain d1nkwz_: 1nkw Z: [80610]

Details for d1nkwz_

PDB Entry: 1nkw (more details), 3.1 Å

PDB Description: Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans
PDB Compounds: (Z:) 50S ribosomal protein L32

SCOP Domain Sequences for d1nkwz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nkwz_ i.1.1.2 (Z:) 50S subunit {Deinococcus radiodurans [TaxId: 1299]}
akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla

SCOP Domain Coordinates for d1nkwz_:

Click to download the PDB-style file with coordinates for d1nkwz_.
(The format of our PDB-style files is described here.)

Timeline for d1nkwz_: