SCOP 1.73: Domain d1nkwk_: 1nkw K:

Lineage for d1nkwk_ (1nkw K:)

1. Root: SCOP 1.73

2. Class i: Low resolution protein structures [58117] (26 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (1 protein)

6. Protein 50S subunit [58125] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)

8. Domain d1nkwk_: 1nkw K: [80596]

Details for d1nkwk_

PDB Entry: 1nkw, 3.1 Å

PDB Description: Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans

PDB Compounds: (K:) 50S ribosomal protein L16

SCOP Domain Sequences for d1nkwk_:

Sequence; same for both SEQRES and ATOM records:

>d1nkwk_ i.1.1.2 (K:) 50S subunit {Deinococcus radiodurans [TaxId: 1299]}
tkfrkqfrgrmtgdakggdyvafgdygliamepawiksnqieacrivmsrhfrrggkiyi
rifpdkpvtkkpaetrmgkgkgaveywvsvvkpgrvmfevagvteeqakeafrlaghklp
iqtk

Timeline for d1nkwk_:

• d1nkwk_ first appeared in SCOP 1.63
  
• d1nkwk_ appears in SCOP 1.71
  
• d1nkwk_ appears in SCOP 1.75
  
• d1nkwk_ appears in the current release, SCOPe 2.08