SCOPe 2.08: Domain d1nkwg_: 1nkw G:

Lineage for d1nkwg_ (1nkw G:)

1. Root: SCOPe 2.08

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (3 proteins)

6. Protein Prokaryotic (50S subunit) [58125] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)

8. Domain d1nkwg_: 1nkw G: [80592]
   CA-atoms only for the ribosomal protein structures

Details for d1nkwg_

PDB Entry: 1nkw, 3.1 Å

PDB Description: Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans

PDB Compounds: (G:) 50S ribosomal protein L11

SCOPe Domain Sequences for d1nkwg_:

Sequence; same for both SEQRES and ATOM records:

>d1nkwg_ i.1.1.2 (G:) Prokaryotic (50S subunit) {Deinococcus radiodurans [TaxId: 1299]}
mkkvagivklqlpagkatpappvgpalgqyganimeftkafnaqtadkgdaiipveitiy
adrsftfitktppmsylirkaagigkgsstpnkakvgklnwdqvleiaktkmpdlnagsv
eaaantvagtarsmgvtveggpn

Timeline for d1nkwg_:

• d1nkwg_ first appeared in SCOP 1.63
  
• d1nkwg_ appears in SCOPe 2.07